Lineage for d1aoza2 (1aoz A:130-338)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791547Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 791548Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)
  8. 791550Domain d1aoza2: 1aoz A:130-338 [23125]

Details for d1aoza2

PDB Entry: 1aoz (more details), 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution
PDB Compounds: (A:) ascorbate oxidase

SCOP Domain Sequences for d1aoza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

SCOP Domain Coordinates for d1aoza2:

Click to download the PDB-style file with coordinates for d1aoza2.
(The format of our PDB-style files is described here.)

Timeline for d1aoza2: