SCOPe 2.05: Domain d2r9ua_: 2r9u A:

Lineage for d2r9ua_ (2r9u A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (10 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries)

8. Domain d2r9ua_: 2r9u A: [231247]
   automated match to d2o6ra_

Details for d2r9ua_

PDB Entry: 2r9u, 2.1 Å

PDB Description: Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain

PDB Compounds: (A:) Variable lymphocyte receptor

SCOPe Domain Sequences for d2r9ua_:

Sequence; same for both SEQRES and ATOM records:

>d2r9ua_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
hhsagcpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlq
qlyfnsnkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdce
crdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc

Timeline for d2r9ua_:

• d2r9ua_ first appeared in SCOPe 2.03
  
• d2r9ua_ appears in SCOPe 2.04
  
• d2r9ua_ is called d2r9ua1 in SCOPe 2.06
  
• d2r9ua_ appears in the current release, SCOPe 2.08, called d2r9ua1