Lineage for d2r58a1 (2r58 A:175-281)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784806Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries)
  8. 2784811Domain d2r58a1: 2r58 A:175-281 [231242]
    Other proteins in same PDB: d2r58a3
    automated match to d1oi1a1
    complexed with mly

Details for d2r58a1

PDB Entry: 2r58 (more details), 2 Å

PDB Description: crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with di-methyl lysine
PDB Compounds: (A:) Polycomb protein Scm

SCOPe Domain Sequences for d2r58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r58a1 b.34.9.0 (A:175-281) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fdwdayleetgseaapakcfkqaqnppnndfkigmklealdprnvtstciatvvgvlgsr
lrlrldgsdsqndfwrlvdsteihaighceknggmlqpplgfcmnas

SCOPe Domain Coordinates for d2r58a1:

Click to download the PDB-style file with coordinates for d2r58a1.
(The format of our PDB-style files is described here.)

Timeline for d2r58a1: