Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries) |
Domain d2r57a2: 2r57 A:282-383 [231241] Other proteins in same PDB: d2r57a3 automated match to d1oi1a2 |
PDB Entry: 2r57 (more details), 2.2 Å
SCOPe Domain Sequences for d2r57a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r57a2 b.34.9.0 (A:282-383) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} swpgylckilnnamvapeeifqpeppepeenlfkvgqkleavdkknpqliccatvdaikd dqihvtfdgwrgafdywcnyrsrdifpagwcarschpmqppg
Timeline for d2r57a2: