Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Ascorbate oxidase [49555] (1 species) consists of three domains of this fold |
Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries) |
Domain d1aoza1: 1aoz A:1-129 [23124] complexed with c1o, c2o, cu, nag |
PDB Entry: 1aoz (more details), 1.9 Å
SCOPe Domain Sequences for d1aoza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli vdppqgkke
Timeline for d1aoza1: