SCOPe 2.06: Domain d1aoza1: 1aoz A:1-129

Lineage for d1aoza1 (1aoz A:1-129)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Ascorbate oxidase [49555] (1 species)
   consists of three domains of this fold

7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)

8. Domain d1aoza1: 1aoz A:1-129 [23124]
   complexed with c1o, c2o, cu, nag

Details for d1aoza1

PDB Entry: 1aoz, 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution

PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1aoza1:

Sequence; same for both SEQRES and ATOM records:

>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke

Timeline for d1aoza1:

• d1aoza1 first appeared (with stable ids) in SCOP 1.55
  
• d1aoza1 appears in SCOPe 2.05
  
• d1aoza1 appears in SCOPe 2.07
  
• d1aoza1 appears in the current release, SCOPe 2.08