Lineage for d1aoza1 (1aoz A:1-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771265Protein Ascorbate oxidase, N-terminal domain [418902] (1 species)
    protein consists of three domains of this fold
  7. 2771266Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419304] (4 PDB entries)
  8. 2771267Domain d1aoza1: 1aoz A:1-129 [23124]
    Other proteins in same PDB: d1aoza2, d1aoza3, d1aozb2, d1aozb3
    complexed with c1o, c2o, cu, nag

Details for d1aoza1

PDB Entry: 1aoz (more details), 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution
PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1aoza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase, N-terminal domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke

SCOPe Domain Coordinates for d1aoza1:

Click to download the PDB-style file with coordinates for d1aoza1.
(The format of our PDB-style files is described here.)

Timeline for d1aoza1: