SCOPe 2.08: Domain d2qwzc_: 2qwz C:

Lineage for d2qwzc_ (2qwz C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Silicibacter sp. [TaxId:292414] [231234] (1 PDB entry)

8. Domain d2qwzc_: 2qwz C: [231237]
   Other proteins in same PDB: d2qwza2, d2qwzb2
   automated match to d2h4ud_
   complexed with act, gol

Details for d2qwzc_

PDB Entry: 2qwz, 2.15 Å

PDB Description: crystal structure of a putative thioesterase (tm1040_1390) from silicibacter sp. tm1040 at 2.15 a resolution

PDB Compounds: (C:) Phenylacetic acid degradation-related protein

SCOPe Domain Sequences for d2qwzc_:

Sequence; same for both SEQRES and ATOM records:

>d2qwzc_ d.38.1.0 (C:) automated matches {Silicibacter sp. [TaxId: 292414]}
melvfdkdglsayleevfpqiqgefsidalakgeitmrlnvqerhlrpggtvsgpsmfal
advsvyalvlahlgrealavttnasldfmrkpesgrdllgqarllklgrtlavgdillfs
egmeapvarstmtysipp

Timeline for d2qwzc_:

• d2qwzc_ first appeared in SCOPe 2.03
  
• d2qwzc_ appears in SCOPe 2.07