SCOPe 2.06: Domain d2qwza1: 2qwz A:1-138

Lineage for d2qwza1 (2qwz A:1-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (36 species)
   not a true protein

7. Species Silicibacter sp. [TaxId:292414] [231234] (1 PDB entry)

8. Domain d2qwza1: 2qwz A:1-138 [231235]
   Other proteins in same PDB: d2qwza2, d2qwzb2
   automated match to d2h4ud_
   complexed with act, gol

Details for d2qwza1

PDB Entry: 2qwz, 2.15 Å

PDB Description: crystal structure of a putative thioesterase (tm1040_1390) from silicibacter sp. tm1040 at 2.15 a resolution

PDB Compounds: (A:) Phenylacetic acid degradation-related protein

SCOPe Domain Sequences for d2qwza1:

Sequence; same for both SEQRES and ATOM records:

>d2qwza1 d.38.1.0 (A:1-138) automated matches {Silicibacter sp. [TaxId: 292414]}
melvfdkdglsayleevfpqiqgefsidalakgeitmrlnvqerhlrpggtvsgpsmfal
advsvyalvlahlgrealavttnasldfmrkpesgrdllgqarllklgrtlavgdillfs
egmeapvarstmtysipp

Timeline for d2qwza1:

• d2qwza1 first appeared in SCOPe 2.03, called d2qwza_
  
• d2qwza1 was called d2qwza_ in SCOPe 2.05
  
• d2qwza1 appears in SCOPe 2.07
  
• d2qwza1 appears in the current release, SCOPe 2.08