Lineage for d2qsja1 (2qsj A:2-131)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856115Species Silicibacter pomeroyi [TaxId:246200] [231231] (1 PDB entry)
  8. 2856116Domain d2qsja1: 2qsj A:2-131 [231232]
    Other proteins in same PDB: d2qsja2, d2qsjb2
    automated match to d3crna_

Details for d2qsja1

PDB Entry: 2qsj (more details), 2.1 Å

PDB Description: crystal structure of a luxr family dna-binding response regulator from silicibacter pomeroyi
PDB Compounds: (A:) DNA-binding response regulator, LuxR family

SCOPe Domain Sequences for d2qsja1:

Sequence, based on SEQRES records: (download)

>d2qsja1 c.23.1.0 (A:2-131) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
tvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnlpda
eaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavslile
geiflprsyl

Sequence, based on observed residues (ATOM records): (download)

>d2qsja1 c.23.1.0 (A:2-131) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
tvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidgl
vrlkrfdpsnavaliheliraaleagadgfipksadpqvlihavslilegeiflprsyl

SCOPe Domain Coordinates for d2qsja1:

Click to download the PDB-style file with coordinates for d2qsja1.
(The format of our PDB-style files is described here.)

Timeline for d2qsja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qsja2