![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Silicibacter pomeroyi [TaxId:246200] [231231] (1 PDB entry) |
![]() | Domain d2qsja1: 2qsj A:2-131 [231232] Other proteins in same PDB: d2qsja2, d2qsjb2 automated match to d3crna_ |
PDB Entry: 2qsj (more details), 2.1 Å
SCOPe Domain Sequences for d2qsja1:
Sequence, based on SEQRES records: (download)
>d2qsja1 c.23.1.0 (A:2-131) automated matches {Silicibacter pomeroyi [TaxId: 246200]} tvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnlpda eaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavslile geiflprsyl
>d2qsja1 c.23.1.0 (A:2-131) automated matches {Silicibacter pomeroyi [TaxId: 246200]} tvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidgl vrlkrfdpsnavaliheliraaleagadgfipksadpqvlihavslilegeiflprsyl
Timeline for d2qsja1: