Lineage for d1ndrc2 (1ndr C:167-340)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. 2771665Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries)
    Uniprot O68601
  8. 2771704Domain d1ndrc2: 1ndr C:167-340 [23123]
    Other proteins in same PDB: d1ndra1, d1ndrb1, d1ndrc1
    CA-atoms only
    complexed with cu

    has additional insertions and/or extensions that are not grouped together

Details for d1ndrc2

PDB Entry: 1ndr (more details), 3 Å

PDB Description: crystallographic structure of a blue copper nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1ndrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndrc2 b.6.1.3 (C:167-340) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
gaalaydrvytigesdlyvpkaadgnysdypalasayadtvavmrtltpshavfngavga
ltganaltaavgesvliihsqanrdsrphligghgdwvwttgkfanppqlnmetwfipgg
saaaalytfkqpgtyaylshnlieamelgaaaqasvegqwdddlmtsvaapgpa

SCOPe Domain Coordinates for d1ndrc2:

Click to download the PDB-style file with coordinates for d1ndrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ndrc2: