Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:4896] [231218] (3 PDB entries) |
Domain d2qrce2: 2qrc E:182-334 [231228] Other proteins in same PDB: d2qrca_, d2qrcb_, d2qrcc_, d2qrcd_ automated match to d2ooxe2 complexed with adp, amp |
PDB Entry: 2qrc (more details), 2.7 Å
SCOPe Domain Sequences for d2qrce2:
Sequence, based on SEQRES records: (download)
>d2qrce2 d.37.1.1 (E:182-334) automated matches {Schizosaccharomyces pombe [TaxId: 4896]} vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle gilsladilnyiiydktttpgvpeqtdnfesav
>d2qrce2 d.37.1.1 (E:182-334) automated matches {Schizosaccharomyces pombe [TaxId: 4896]} vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle gilsladilnyiiydkttdnfesav
Timeline for d2qrce2: