| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein automated matches [190627] (6 species) not a true protein |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries) |
| Domain d2qrdg1: 2qrd G:1-181 [231223] Other proteins in same PDB: d2qrda_, d2qrdb_, d2qrdc_, d2qrdd_ automated match to d2ooxe1 complexed with adp, atp |
PDB Entry: 2qrd (more details), 2.41 Å
SCOPe Domain Sequences for d2qrdg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qrdg1 d.37.1.1 (G:1-181) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
amdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsapl
wdseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippeti
yvhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketaml
r
Timeline for d2qrdg1: