SCOPe 2.05: Domain d2qrcg1: 2qrc G:1-181

Lineage for d2qrcg1 (2qrc G:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (6 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries)

8. Domain d2qrcg1: 2qrc G:1-181 [231222]
   Other proteins in same PDB: d2qrca_, d2qrcb_, d2qrcc_, d2qrcd_
   automated match to d2ooxe1
   complexed with adp, amp

Details for d2qrcg1

PDB Entry: 2qrc, 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP

PDB Compounds: (G:) Protein C1556.08c

SCOPe Domain Sequences for d2qrcg1:

Sequence; same for both SEQRES and ATOM records:

>d2qrcg1 d.37.1.1 (G:1-181) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
amdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsapl
wdseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippeti
yvhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketaml
r

Timeline for d2qrcg1:

• d2qrcg1 first appeared in SCOPe 2.03
  
• d2qrcg1 appears in SCOPe 2.04
  
• d2qrcg1 appears in SCOPe 2.06
  
• d2qrcg1 appears in the current release, SCOPe 2.08