Lineage for d1ndrc1 (1ndr C:11-166)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940701Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 940824Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 941045Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 941146Domain d1ndrc1: 1ndr C:11-166 [23122]
    CA-atoms only
    complexed with cu

Details for d1ndrc1

PDB Entry: 1ndr (more details), 3 Å

PDB Description: crystallographic structure of a blue copper nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1ndrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndrc1 b.6.1.3 (C:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa

SCOPe Domain Coordinates for d1ndrc1:

Click to download the PDB-style file with coordinates for d1ndrc1.
(The format of our PDB-style files is described here.)

Timeline for d1ndrc1: