| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries) Uniprot O68601 25-360 Uniprot O68601 26-359 Uniprot O68601 Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601 |
| Domain d1ndrc1: 1ndr C:11-166 [23122] CA-atoms only |
PDB Entry: 1ndr (more details), 3 Å
SCOP Domain Sequences for d1ndrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndrc1 b.6.1.3 (C:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa
Timeline for d1ndrc1:
View in 3DDomains from other chains: (mouse over for more information) d1ndra1, d1ndra2, d1ndrb1, d1ndrb2 |