Lineage for d2qlvf1 (2qlv F:7-185)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409742Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1409743Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1409744Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1409866Protein automated matches [190627] (7 species)
    not a true protein
  7. 1409878Species Saccharomyces cerevisiae [TaxId:4932] [231212] (1 PDB entry)
  8. 1409881Domain d2qlvf1: 2qlv F:7-185 [231215]
    Other proteins in same PDB: d2qlva1, d2qlvb1, d2qlvb2, d2qlvd_, d2qlve1, d2qlve2
    automated match to d2ooxe1

Details for d2qlvf1

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (F:) Nuclear protein SNF4

SCOPe Domain Sequences for d2qlvf1:

Sequence, based on SEQRES records: (download)

>d2qlvf1 d.37.1.1 (F:7-185) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
hpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Sequence, based on observed residues (ATOM records): (download)

>d2qlvf1 d.37.1.1 (F:7-185) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
hpsrplfeaclkmlesrsgriplidqreivvsvltqyrilkfvalncrethflk

SCOPe Domain Coordinates for d2qlvf1:

Click to download the PDB-style file with coordinates for d2qlvf1.
(The format of our PDB-style files is described here.)

Timeline for d2qlvf1: