Lineage for d2qkmh1 (2qkm H:1-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738104Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
    4 helices; orthogonal array of two alpha hairpins
  4. 2738105Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) (S)
    automatically mapped to Pfam PF05026
  5. 2738106Family a.242.1.1: Dcp2 box A domain [140587] (1 protein)
    Pfam PF05026
  6. 2738107Protein mRNA decapping enzyme Dcp2p, N-terminal domain [140588] (1 species)
  7. 2738108Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [140589] (3 PDB entries)
    Uniprot O13828 1-94
  8. 2738112Domain d2qkmh1: 2qkm H:1-94 [231210]
    Other proteins in same PDB: d2qkmd2, d2qkmh2
    automated match to d2a6ta1
    protein/RNA complex; complexed with atp

Details for d2qkmh1

PDB Entry: 2qkm (more details), 2.8 Å

PDB Description: The crystal structure of fission yeast mRNA decapping enzyme Dcp1-Dcp2 complex
PDB Compounds: (H:) SPAC19A8.12 protein

SCOPe Domain Sequences for d2qkmh1:

Sequence, based on SEQRES records: (download)

>d2qkmh1 a.242.1.1 (H:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

Sequence, based on observed residues (ATOM records): (download)

>d2qkmh1 a.242.1.1 (H:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahckwskvheeafddflrykt

SCOPe Domain Coordinates for d2qkmh1:

Click to download the PDB-style file with coordinates for d2qkmh1.
(The format of our PDB-style files is described here.)

Timeline for d2qkmh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkmh2