Lineage for d2qkmd2 (2qkm D:95-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971774Family d.113.1.7: mRNA decapping enzyme-like [143777] (2 proteins)
    part of Pfam PF00293
  6. 2971779Protein automated matches [231207] (2 species)
    not a true protein
  7. 2971780Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231208] (1 PDB entry)
  8. 2971781Domain d2qkmd2: 2qkm D:95-233 [231209]
    Other proteins in same PDB: d2qkmd1, d2qkmh1
    automated match to d2a6ta2
    protein/RNA complex; complexed with atp

Details for d2qkmd2

PDB Entry: 2qkm (more details), 2.8 Å

PDB Description: The crystal structure of fission yeast mRNA decapping enzyme Dcp1-Dcp2 complex
PDB Compounds: (D:) SPAC19A8.12 protein

SCOPe Domain Sequences for d2qkmd2:

Sequence, based on SEQRES records: (download)

>d2qkmd2 d.113.1.7 (D:95-233) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqt
mknkfymvipflaplkkwi

Sequence, based on observed residues (ATOM records): (download)

>d2qkmd2 d.113.1.7 (D:95-233) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ripvrgaimldmsmqqcvlvwgfpkgkidkdesdvdcairevyeetgfdcssrinpnefi
dmtirgqnvrlyiipgisldtrfesriewhnlmdlptymvipflaplkkwi

SCOPe Domain Coordinates for d2qkmd2:

Click to download the PDB-style file with coordinates for d2qkmd2.
(The format of our PDB-style files is described here.)

Timeline for d2qkmd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkmd1