SCOPe 2.05: Domain d2q13a2: 2q13 A:274-378

Lineage for d2q13a2 (2q13 A:274-378)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d2q13a2: 2q13 A:274-378 [231190]
   Other proteins in same PDB: d2q13a1
   automated match to d2elba2

Details for d2q13a2

PDB Entry: 2q13, 2.05 Å

PDB Description: Crystal structure of BAR-PH domain of APPL1

PDB Compounds: (A:) DCC-interacting protein 13 alpha

SCOPe Domain Sequences for d2q13a2:

Sequence, based on SEQRES records:

>d2q13a2 b.55.1.0 (A:274-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinniskqiy

Sequence, based on observed residues (ATOM records):

>d2q13a2 b.55.1.0 (A:274-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnartwdrqfyftqggnlmsqargdvagglamdidncsvmavdcedrryc
fqitsfdgkkssilqaeskkdheewictinniskqiy

Timeline for d2q13a2:

• d2q13a2 first appeared in SCOPe 2.03
  
• d2q13a2 appears in SCOPe 2.04
  
• d2q13a2 appears in SCOPe 2.06
  
• d2q13a2 appears in the current release, SCOPe 2.08