SCOPe 2.05: Domain d2q2xa_: 2q2x A:

Lineage for d2q2xa_ (2q2x A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Lyngbya majuscula [TaxId:276768] [231186] (3 PDB entries)

8. Domain d2q2xa_: 2q2x A: [231187]
   automated match to d3fdua_
   complexed with gol

Details for d2q2xa_

PDB Entry: 2q2x, 2 Å

PDB Description: crystal structure of the ech2 decarboxylase domain of curf from lyngbya majuscula

PDB Compounds: (A:) CurF

SCOPe Domain Sequences for d2q2xa_:

Sequence; same for both SEQRES and ATOM records:

>d2q2xa_ c.14.1.0 (A:) automated matches {Lyngbya majuscula [TaxId: 276768]}
avvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyfs
sgaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqes
vyatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqdv
lnyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriqq
ef

Timeline for d2q2xa_:

• d2q2xa_ first appeared in SCOPe 2.03
  
• d2q2xa_ appears in SCOPe 2.04
  
• d2q2xa_ is called d2q2xa1 in SCOPe 2.06
  
• d2q2xa_ appears in the current release, SCOPe 2.08, called d2q2xa1