Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Lyngbya majuscula [TaxId:276768] [231186] (3 PDB entries) |
Domain d2q2xa_: 2q2x A: [231187] automated match to d3fdua_ complexed with gol |
PDB Entry: 2q2x (more details), 2 Å
SCOPe Domain Sequences for d2q2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2xa_ c.14.1.0 (A:) automated matches {Lyngbya majuscula [TaxId: 276768]} avvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyfs sgaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqes vyatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqdv lnyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriqq ef
Timeline for d2q2xa_: