Lineage for d2q16b_ (2q16 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1604067Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1604127Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 1604128Protein automated matches [190179] (7 species)
    not a true protein
  7. 1604134Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)
  8. 1604136Domain d2q16b_: 2q16 B: [231185]
    automated match to d3tqua_
    complexed with ca, itt, na, so4

Details for d2q16b_

PDB Entry: 2q16 (more details), 1.95 Å

PDB Description: Structure of the E. coli inosine triphosphate pyrophosphatase RgdB in complex with ITP
PDB Compounds: (B:) HAM1 protein homolog

SCOPe Domain Sequences for d2q16b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q16b_ c.51.4.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakvta
lpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhcvl
vylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksaish
rgqalkllldalr

SCOPe Domain Coordinates for d2q16b_:

Click to download the PDB-style file with coordinates for d2q16b_.
(The format of our PDB-style files is described here.)

Timeline for d2q16b_: