SCOPe 2.08: Domain d2q16a_: 2q16 A:

Lineage for d2q16a_ (2q16 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)

8. Domain d2q16a_: 2q16 A: [231184]
   automated match to d3tqua_
   complexed with ca, itt, na, so4

Details for d2q16a_

PDB Entry: 2q16, 1.95 Å

PDB Description: structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp

PDB Compounds: (A:) HAM1 protein homolog

SCOPe Domain Sequences for d2q16a_:

Sequence; same for both SEQRES and ATOM records:

>d2q16a_ c.51.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakv
talpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhc
vlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksai
shrgqalkllldalrng

Timeline for d2q16a_:

• d2q16a_ first appeared in SCOPe 2.03
  
• d2q16a_ appears in SCOPe 2.07