Lineage for d2q16a_ (2q16 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882193Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)
  8. 2882194Domain d2q16a_: 2q16 A: [231184]
    automated match to d3tqua_
    complexed with ca, itt, na, so4

Details for d2q16a_

PDB Entry: 2q16 (more details), 1.95 Å

PDB Description: structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp
PDB Compounds: (A:) HAM1 protein homolog

SCOPe Domain Sequences for d2q16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q16a_ c.51.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakv
talpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhc
vlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksai
shrgqalkllldalrng

SCOPe Domain Coordinates for d2q16a_:

Click to download the PDB-style file with coordinates for d2q16a_.
(The format of our PDB-style files is described here.)

Timeline for d2q16a_: