Class a: All alpha proteins [46456] (286 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
Protein automated matches [190594] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187606] (4 PDB entries) |
Domain d2q13a1: 2q13 A:4-273 [231182] Other proteins in same PDB: d2q13a2 automated match to d2elba1 |
PDB Entry: 2q13 (more details), 2.05 Å
SCOPe Domain Sequences for d2q13a1:
Sequence, based on SEQRES records: (download)
>d2q13a1 a.238.1.1 (A:4-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltsk llkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdl keiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfc alntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsd ietmqqtiedlevasdplyvpdpdptkfpv
>d2q13a1 a.238.1.1 (A:4-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltsk llkeyekqrfpldevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkei ltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcaln tlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdiet mqqtiedlevasdplyvpdpdptkfpv
Timeline for d2q13a1: