Lineage for d2pzga_ (2pzg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127048Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2127064Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2127065Species Human (Homo sapiens) [TaxId:9606] [117543] (9 PDB entries)
    Uniprot P13569 389-671
  8. 2127068Domain d2pzga_: 2pzg A: [231181]
    automated match to d2pzgb_
    complexed with atp, gol, mg

Details for d2pzga_

PDB Entry: 2pzg (more details), 1.8 Å

PDB Description: minimal human cftr first nucleotide binding domain as a monomer
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2pzga_:

Sequence, based on SEQRES records: (download)

>d2pzga_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg

Sequence, based on observed residues (ATOM records): (download)

>d2pzga_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnpdfssklmg

SCOPe Domain Coordinates for d2pzga_:

Click to download the PDB-style file with coordinates for d2pzga_.
(The format of our PDB-style files is described here.)

Timeline for d2pzga_: