Lineage for d2psjb_ (2psj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136600Species Renilla reniformis [TaxId:6136] [225269] (5 PDB entries)
  8. 2136605Domain d2psjb_: 2psj B: [231172]
    automated match to d2psfa_
    complexed with cei

Details for d2psjb_

PDB Entry: 2psj (more details), 1.8 Å

PDB Description: Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla Reniformis
PDB Compounds: (B:) Renilla-luciferin 2-monooxygenase

SCOPe Domain Sequences for d2psjb_:

Sequence, based on SEQRES records: (download)

>d2psjb_ c.69.1.0 (B:) automated matches {Renilla reniformis [TaxId: 6136]}
skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh
vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg
aalafhyayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffv
etvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnyna
ylrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksf
vervlkne

Sequence, based on observed residues (ATOM records): (download)

>d2psjb_ c.69.1.0 (B:) automated matches {Renilla reniformis [TaxId: 6136]}
skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh
vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg
aalafhyayehqdrikaivhmesvvdviesewpdieedialikseegekmvlennffvet
vlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnynayl
rasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksfve
rvlkne

SCOPe Domain Coordinates for d2psjb_:

Click to download the PDB-style file with coordinates for d2psjb_.
(The format of our PDB-style files is described here.)

Timeline for d2psjb_: