![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Renilla reniformis [TaxId:6136] [225269] (7 PDB entries) |
![]() | Domain d2psja_: 2psj A: [231171] automated match to d2psfa_ complexed with cei |
PDB Entry: 2psj (more details), 1.8 Å
SCOPe Domain Sequences for d2psja_:
Sequence, based on SEQRES records: (download)
>d2psja_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]} skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg aalafhyayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffv etvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnyna ylrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksf vervlkne
>d2psja_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]} skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg aalafhyayehqdrikaivhmesvvdviesewpdieedialikseegekmvlennffvet vlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnynayl rasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksfve rvlkne
Timeline for d2psja_: