Lineage for d1ndsc2 (1nds C:167-340)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292711Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 292712Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 293018Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 293096Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 293231Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (11 PDB entries)
  8. 293255Domain d1ndsc2: 1nds C:167-340 [23117]
    CA-atoms only
    complexed with cu, no2

Details for d1ndsc2

PDB Entry: 1nds (more details), 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

SCOP Domain Sequences for d1ndsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndsc2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
gaalaydrvytigesdlyvpkaadgnysdypalasayadtvavmrtltpshavfngavga
ltganaltaavgesvliihsqanrdsrphligghgdwvwttgkfanppqlnmetwfipgg
saaaalytfkqpgtyaylshnlieamelgaaaqasvegqwdddlmtsvaapgpa

SCOP Domain Coordinates for d1ndsc2:

Click to download the PDB-style file with coordinates for d1ndsc2.
(The format of our PDB-style files is described here.)

Timeline for d1ndsc2: