Lineage for d1ndsc2 (1nds C:167-340)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56231Protein Nitrite reductase, NIR [49551] (3 species)
  7. 56318Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (6 PDB entries)
  8. 56332Domain d1ndsc2: 1nds C:167-340 [23117]

Details for d1ndsc2

PDB Entry: 1nds (more details), 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

SCOP Domain Sequences for d1ndsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndsc2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
gaalaydrvytigesdlyvpkaadgnysdypalasayadtvavmrtltpshavfngavga
ltganaltaavgesvliihsqanrdsrphligghgdwvwttgkfanppqlnmetwfipgg
saaaalytfkqpgtyaylshnlieamelgaaaqasvegqwdddlmtsvaapgpa

SCOP Domain Coordinates for d1ndsc2:

Click to download the PDB-style file with coordinates for d1ndsc2.
(The format of our PDB-style files is described here.)

Timeline for d1ndsc2: