Lineage for d2psea_ (2pse A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1384148Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1384149Protein automated matches [190543] (40 species)
    not a true protein
  7. 1384338Species Renilla reniformis [TaxId:6136] [225269] (5 PDB entries)
  8. 1384345Domain d2psea_: 2pse A: [231169]
    automated match to d2psfa_
    complexed with imd

Details for d2psea_

PDB Entry: 2pse (more details), 2.5 Å

PDB Description: crystal structures of the luciferase and green fluorescent protein from renilla reniformis
PDB Compounds: (A:) Renilla-luciferin 2-monooxygenase

SCOPe Domain Sequences for d2psea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psea_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]}
kvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrhv
vphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwga
alafhyayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffve
tvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnynay
lrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksfv
ervlk

SCOPe Domain Coordinates for d2psea_:

Click to download the PDB-style file with coordinates for d2psea_.
(The format of our PDB-style files is described here.)

Timeline for d2psea_: