Lineage for d2pmha2 (2pmh A:61-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557409Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries)
  8. 2557411Domain d2pmha2: 2pmh A:61-150 [231162]
    Other proteins in same PDB: d2pmha1
    automated match to d2cyya2
    complexed with gln, mg, na

Details for d2pmha2

PDB Entry: 2pmh (more details), 1.9 Å

PDB Description: crystal structure of thr132ala of st1022 from sulfolobus tokodaii
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2pmha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmha2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipeverastqvvvkiikespnivif

SCOPe Domain Coordinates for d2pmha2:

Click to download the PDB-style file with coordinates for d2pmha2.
(The format of our PDB-style files is described here.)

Timeline for d2pmha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pmha1