Lineage for d1ndsc1 (1nds C:11-166)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11202Protein Nitrite reductase, NIR [49551] (3 species)
  7. 11265Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (4 PDB entries)
  8. 11274Domain d1ndsc1: 1nds C:11-166 [23116]

Details for d1ndsc1

PDB Entry: 1nds (more details), 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

SCOP Domain Sequences for d1ndsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndsc1 b.6.1.3 (C:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa

SCOP Domain Coordinates for d1ndsc1:

Click to download the PDB-style file with coordinates for d1ndsc1.
(The format of our PDB-style files is described here.)

Timeline for d1ndsc1: