| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (159 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries) |
| Domain d2plaa1: 2pla A:4-195 [231158] Other proteins in same PDB: d2plaa2 automated match to d1wpqa1 complexed with cl, nad, po4 |
PDB Entry: 2pla (more details), 2.51 Å
SCOPe Domain Sequences for d2plaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plaa1 c.2.1.0 (A:4-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndhenv
kylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitlikg
idegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfkell
qtpnfritvvdd
Timeline for d2plaa1: