Lineage for d2pgwc2 (2pgw C:132-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837780Species Sinorhizobium meliloti [TaxId:266834] [231148] (1 PDB entry)
  8. 2837783Domain d2pgwc2: 2pgw C:132-376 [231155]
    Other proteins in same PDB: d2pgwa1, d2pgwb1, d2pgwc1, d2pgwc3, d2pgwd1, d2pgwe1, d2pgwf1, d2pgwg1, d2pgwh1
    automated match to d4mggf2
    complexed with gol

Details for d2pgwc2

PDB Entry: 2pgw (more details), 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021
PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgwc2 c.1.11.0 (C:132-376) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaavrgeigda
rlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgipivadqaaf
tlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssfttgittcaeh
higlaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaedlvaegegr
yaasr

SCOPe Domain Coordinates for d2pgwc2:

Click to download the PDB-style file with coordinates for d2pgwc2.
(The format of our PDB-style files is described here.)

Timeline for d2pgwc2: