SCOPe 2.06: Domain d2pgwd2: 2pgw D:132-375

Lineage for d2pgwd2 (2pgw D:132-375)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [231148] (1 PDB entry)

8. Domain d2pgwd2: 2pgw D:132-375 [231154]
   Other proteins in same PDB: d2pgwa1, d2pgwb1, d2pgwc1, d2pgwc3, d2pgwd1, d2pgwe1, d2pgwf1, d2pgwg1, d2pgwh1
   automated match to d4mggf2
   complexed with gol

Details for d2pgwd2

PDB Entry: 2pgw, 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021

PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwd2:

Sequence; same for both SEQRES and ATOM records:

>d2pgwd2 c.1.11.0 (D:132-375) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaavrgeigda
rlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgipivadqaaf
tlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssfttgittcaeh
higlaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaedlvaegegr
yaas

Timeline for d2pgwd2:

• d2pgwd2 first appeared in SCOPe 2.03
  
• d2pgwd2 appears in SCOPe 2.05
  
• d2pgwd2 appears in SCOPe 2.07
  
• d2pgwd2 appears in the current release, SCOPe 2.08