Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [231146] (1 PDB entry) |
Domain d2pgwc1: 2pgw C:4-131 [231153] Other proteins in same PDB: d2pgwa2, d2pgwb2, d2pgwc2, d2pgwd2, d2pgwe2 automated match to d4mggf1 complexed with gol |
PDB Entry: 2pgw (more details), 1.95 Å
SCOPe Domain Sequences for d2pgwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgwc1 d.54.1.0 (C:4-131) automated matches {Sinorhizobium meliloti [TaxId: 266834]} vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl pvhqllgg
Timeline for d2pgwc1: