SCOPe 2.06: Domain d2pgwb1: 2pgw B:4-131

Lineage for d2pgwb1 (2pgw B:4-131)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [231146] (1 PDB entry)

8. Domain d2pgwb1: 2pgw B:4-131 [231147]
   Other proteins in same PDB: d2pgwa2, d2pgwb2, d2pgwc2, d2pgwc3, d2pgwd2, d2pgwe2, d2pgwf2, d2pgwg2, d2pgwh2
   automated match to d4mggf1
   complexed with gol

Details for d2pgwb1

PDB Entry: 2pgw, 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwb1:

Sequence; same for both SEQRES and ATOM records:

>d2pgwb1 d.54.1.0 (B:4-131) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
pvhqllgg

Timeline for d2pgwb1:

• d2pgwb1 first appeared in SCOPe 2.03
  
• d2pgwb1 appears in SCOPe 2.05
  
• d2pgwb1 appears in SCOPe 2.07
  
• d2pgwb1 appears in the current release, SCOPe 2.08