Lineage for d2p9je_ (2p9j E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629213Species Aquifex aeolicus [TaxId:224324] [188261] (2 PDB entries)
  8. 1629218Domain d2p9je_: 2p9j E: [231142]
    automated match to d4hgnb_

Details for d2p9je_

PDB Entry: 2p9j (more details), 2.4 Å

PDB Description: crystal structure of aq2171 from aquifex aeolicus
PDB Compounds: (E:) Hypothetical protein AQ2171

SCOPe Domain Sequences for d2p9je_:

Sequence, based on SEQRES records: (download)

>d2p9je_ c.108.1.0 (E:) automated matches {Aquifex aeolicus [TaxId: 224324]}
alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
fpvavrnaveevrkvavyitqrnggegalrevaelihflkn

Sequence, based on observed residues (ATOM records): (download)

>d2p9je_ c.108.1.0 (E:) automated matches {Aquifex aeolicus [TaxId: 224324]}
alrdrvkklkllimdidgvltdgklyytikvfnvldgigikllqkmgitlavisgsapli
trlkelgveeiytgskkleiyekikekyslkdeeigfigddvvdievmkkvgfpvavrna
veevrkvavyitqrnggegalrevaelihflkn

SCOPe Domain Coordinates for d2p9je_:

Click to download the PDB-style file with coordinates for d2p9je_.
(The format of our PDB-style files is described here.)

Timeline for d2p9je_: