| Class b: All beta proteins [48724] (119 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) |
| Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
| Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (9 PDB entries) |
| Domain d1ndsb1: 1nds B:11-166 [23114] |
PDB Entry: 1nds (more details), 2.8 Å
SCOP Domain Sequences for d1ndsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndsb1 b.6.1.3 (B:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa
Timeline for d1ndsb1:
View in 3DDomains from other chains: (mouse over for more information) d1ndsa1, d1ndsa2, d1ndsc1, d1ndsc2 |