SCOP 1.55: Domain d1ndsb1: 1nds B:11-166

Lineage for d1ndsb1 (1nds B:11-166)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (3 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)

6. Protein Nitrite reductase, NIR [49551] (3 species)

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (4 PDB entries)

8. Domain d1ndsb1: 1nds B:11-166 [23114]

Details for d1ndsb1

PDB Entry: 1nds, 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

SCOP Domain Sequences for d1ndsb1:

Sequence; same for both SEQRES and ATOM records:

>d1ndsb1 b.6.1.3 (B:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa

Timeline for d1ndsb1:

• d1ndsb1 appears in SCOP 1.57
  
• d1ndsb1 appears in the current release, SCOPe 2.08