Lineage for d2p9jd_ (2p9j D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920272Species Aquifex aeolicus [TaxId:224324] [188261] (2 PDB entries)
  8. 2920278Domain d2p9jd_: 2p9j D: [231139]
    automated match to d4hgnb_

Details for d2p9jd_

PDB Entry: 2p9j (more details), 2.4 Å

PDB Description: crystal structure of aq2171 from aquifex aeolicus
PDB Compounds: (D:) Hypothetical protein AQ2171

SCOPe Domain Sequences for d2p9jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9jd_ c.108.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]}
alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
fpvavrnaveevrkvavyitqrnggegalrevaelihflkn

SCOPe Domain Coordinates for d2p9jd_:

Click to download the PDB-style file with coordinates for d2p9jd_.
(The format of our PDB-style files is described here.)

Timeline for d2p9jd_: