Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187400] (65 PDB entries) |
Domain d2p6xa_: 2p6x A: [231137] automated match to d2p6xb_ complexed with cl, edo |
PDB Entry: 2p6x (more details), 1.9 Å
SCOPe Domain Sequences for d2p6xa_:
Sequence, based on SEQRES records: (download)
>d2p6xa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdqreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknry kdilpydysrvelslitsdedssyinanfikgvygpkayiatqgplsttlldfwrmiwey svliivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfns etrtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicai dytwmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvirdk hsa
>d2p6xa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdqreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknry kdilpydysrvelslitdedssyinanfikgvygpkayiatqgplsttlldfwrmiweys vliivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfnse trtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicaid ytwmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvirdkh sa
Timeline for d2p6xa_: