Lineage for d2p6xa1 (2p6x A:1-302)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (116 PDB entries)
  8. 2116698Domain d2p6xa1: 2p6x A:1-302 [231137]
    Other proteins in same PDB: d2p6xa2
    automated match to d2p6xb_
    complexed with cl, edo

Details for d2p6xa1

PDB Entry: 2p6x (more details), 1.9 Å

PDB Description: crystal structure of human tyrosine phosphatase ptpn22
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 22

SCOPe Domain Sequences for d2p6xa1:

Sequence, based on SEQRES records: (download)

>d2p6xa1 c.45.1.0 (A:1-302) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdqreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknry
kdilpydysrvelslitsdedssyinanfikgvygpkayiatqgplsttlldfwrmiwey
svliivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfns
etrtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicai
dytwmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvirdk
hs

Sequence, based on observed residues (ATOM records): (download)

>d2p6xa1 c.45.1.0 (A:1-302) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdqreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknry
kdilpydysrvelslitdedssyinanfikgvygpkayiatqgplsttlldfwrmiweys
vliivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfnse
trtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicaid
ytwmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvirdkh
s

SCOPe Domain Coordinates for d2p6xa1:

Click to download the PDB-style file with coordinates for d2p6xa1.
(The format of our PDB-style files is described here.)

Timeline for d2p6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p6xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2p6xb_