Lineage for d2p5vd1 (2p5v D:3-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308342Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries)
  8. 2308346Domain d2p5vd1: 2p5v D:3-65 [231134]
    Other proteins in same PDB: d2p5va2, d2p5vb2, d2p5vc2, d2p5vd2, d2p5ve2, d2p5vf2, d2p5vg2, d2p5vh2
    automated match to d2cyya1
    complexed with ca, cl, gol

Details for d2p5vd1

PDB Entry: 2p5v (more details), 1.99 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis
PDB Compounds: (D:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p5vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5vd1 a.4.5.0 (D:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
svn

SCOPe Domain Coordinates for d2p5vd1:

Click to download the PDB-style file with coordinates for d2p5vd1.
(The format of our PDB-style files is described here.)

Timeline for d2p5vd1: