| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (41 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [231118] (1 PDB entry) |
| Domain d2p5vd1: 2p5v D:3-65 [231134] Other proteins in same PDB: d2p5va2, d2p5vb2, d2p5vc2, d2p5ve2, d2p5vf2, d2p5vg2, d2p5vh2 automated match to d2cyya1 complexed with ca, cl, gol |
PDB Entry: 2p5v (more details), 1.99 Å
SCOPe Domain Sequences for d2p5vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5vd1 a.4.5.0 (D:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
svn
Timeline for d2p5vd1: