| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
| Protein automated matches [190081] (27 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries) |
| Domain d2p5vf2: 2p5v F:66-158 [231133] Other proteins in same PDB: d2p5va1, d2p5vb1, d2p5vc1, d2p5vd1, d2p5ve1, d2p5vf1, d2p5vg1, d2p5vh1 automated match to d2cyya2 complexed with ca, cl, gol |
PDB Entry: 2p5v (more details), 1.99 Å
SCOPe Domain Sequences for d2p5vf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5vf2 d.58.4.0 (F:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll
Timeline for d2p5vf2: