SCOPe 2.07: Domain d2p5vg1: 2p5v G:1-65

Lineage for d2p5vg1 (2p5v G:1-65)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries)

8. Domain d2p5vg1: 2p5v G:1-65 [231126]
   Other proteins in same PDB: d2p5va2, d2p5vb2, d2p5vc2, d2p5vd2, d2p5ve2, d2p5vf2, d2p5vg2, d2p5vh2
   automated match to d2cyya1
   complexed with ca, cl, gol

Details for d2p5vg1

PDB Entry: 2p5v, 1.99 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis

PDB Compounds: (G:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p5vg1:

Sequence; same for both SEQRES and ATOM records:

>d2p5vg1 a.4.5.0 (G:1-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
mpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaalls
pesvn

Timeline for d2p5vg1:

• d2p5vg1 first appeared in SCOPe 2.03
  
• d2p5vg1 appears in SCOPe 2.06
  
• d2p5vg1 appears in the current release, SCOPe 2.08