SCOPe 2.08: Domain d2p4qa2: 2p4q A:176-476

Lineage for d2p4qa2 (2p4q A:176-476)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231116] (1 PDB entry)

8. Domain d2p4qa2: 2p4q A:176-476 [231117]
   Other proteins in same PDB: d2p4qa1
   automated match to d2pgda1
   complexed with flc

Details for d2p4qa2

PDB Entry: 2p4q, 2.37 Å

PDB Description: Crystal Structure Analysis of Gnd1 in Saccharomyces cerevisiae

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating 1

SCOPe Domain Sequences for d2p4qa2:

Sequence; same for both SEQRES and ATOM records:

>d2p4qa2 a.100.1.0 (A:176-476) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gaghyvkmvhngieygdmqliceaydimkrlggftdkeisdvfakwnngvldsflveitr
dilkfddvdgkplvekimdtagqkgtgkwtainaldlgmpvtligeavfarclsalkner
iraskvlpgpevpkdavkdreqfvddleqalyaskiisyaqgfmlireaaatygwklnnp
aialmwrggciirsvflgqitkayreepdlenllfnkffadavtkaqsgwrksialatty
giptpafstalsfydgyrserlpanllqaqrdyfgahtfrvlpecasdnlpvdkdihinw
t

Timeline for d2p4qa2:

• d2p4qa2 first appeared in SCOPe 2.03
  
• d2p4qa2 appears in SCOPe 2.07