Lineage for d2p4qa2 (2p4q A:176-476)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721549Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231116] (1 PDB entry)
  8. 2721550Domain d2p4qa2: 2p4q A:176-476 [231117]
    Other proteins in same PDB: d2p4qa1
    automated match to d2pgda1
    complexed with flc

Details for d2p4qa2

PDB Entry: 2p4q (more details), 2.37 Å

PDB Description: Crystal Structure Analysis of Gnd1 in Saccharomyces cerevisiae
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating 1

SCOPe Domain Sequences for d2p4qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4qa2 a.100.1.0 (A:176-476) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gaghyvkmvhngieygdmqliceaydimkrlggftdkeisdvfakwnngvldsflveitr
dilkfddvdgkplvekimdtagqkgtgkwtainaldlgmpvtligeavfarclsalkner
iraskvlpgpevpkdavkdreqfvddleqalyaskiisyaqgfmlireaaatygwklnnp
aialmwrggciirsvflgqitkayreepdlenllfnkffadavtkaqsgwrksialatty
giptpafstalsfydgyrserlpanllqaqrdyfgahtfrvlpecasdnlpvdkdihinw
t

SCOPe Domain Coordinates for d2p4qa2:

Click to download the PDB-style file with coordinates for d2p4qa2.
(The format of our PDB-style files is described here.)

Timeline for d2p4qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p4qa1