SCOPe 2.06: Domain d2p4qa1: 2p4q A:1-175

Lineage for d2p4qa1 (2p4q A:1-175)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (2 PDB entries)

8. Domain d2p4qa1: 2p4q A:1-175 [231115]
   Other proteins in same PDB: d2p4qa2
   automated match to d2pgda2
   complexed with flc

Details for d2p4qa1

PDB Entry: 2p4q, 2.37 Å

PDB Description: Crystal Structure Analysis of Gnd1 in Saccharomyces cerevisiae

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating 1

SCOPe Domain Sequences for d2p4qa1:

Sequence; same for both SEQRES and ATOM records:

>d2p4qa1 c.2.1.0 (A:1-175) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msadfgliglavmgqnlilnaadhgftvcaynrtqskvdhflaneakgksiigatsiedf
isklkrprkvmllvkagapvdalinqivpllekgdiiidggnshfpdsnrryeelkkkgi
lfvgsgvsggeegarygpslmpggseeawphiknifqsisaksdgepccewvgpa

Timeline for d2p4qa1:

• d2p4qa1 first appeared in SCOPe 2.03
  
• d2p4qa1 appears in SCOPe 2.05
  
• d2p4qa1 appears in SCOPe 2.07
  
• d2p4qa1 appears in the current release, SCOPe 2.08