Lineage for d2p4hx_ (2p4h X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094320Species Alfalfa (Medicago sativa) [TaxId:3879] [231113] (1 PDB entry)
  8. 2094321Domain d2p4hx_: 2p4h X: [231114]
    automated match to d4lk3a_

Details for d2p4hx_

PDB Entry: 2p4h (more details), 1.4 Å

PDB Description: Crystal Structure of Vestitone Reductase from Alfalfa (Medicago sativa L.)
PDB Compounds: (X:) Vestitone reductase

SCOPe Domain Sequences for d2p4hx_:

Sequence, based on SEQRES records: (download)

>d2p4hx_ c.2.1.0 (X:) automated matches {Alfalfa (Medicago sativa) [TaxId: 3879]}
kgrvcvtggtgflgswiiksllengysvnttiradperkrdvsfltnlpgaseklhffna
dlsnpdsfaaaiegcvgifhtaspidfavsepeeivtkrtvdgalgilkacvnsktvkrf
iytssgsavsfngkdkdvldesdwsdvdllrsvkpfgwnyavsktlaekavlefgeqngi
dvvtlilpfivgrfvcpklpdsiekalvlvlgkkeqigvtrfhmvhvddvarahiyllen
svpggryncspfivpieemsqllsakypeyqiltvdelkeikgarlpdlntkklvdagfd
fkytiedmfddaiqcckekgyl

Sequence, based on observed residues (ATOM records): (download)

>d2p4hx_ c.2.1.0 (X:) automated matches {Alfalfa (Medicago sativa) [TaxId: 3879]}
kgrvcvtggtgflgswiiksllengysvnttiradrdvsfltnlpgaseklhffnadlsn
pdsfaaaiegcvgifhtaspieivtkrtvdgalgilkacvnsktvkrfiytssgsavsfn
gkdkdvldesdwsdvdllrsvkpfgwnyavsktlaekavlefgeqngidvvtlilpfivg
rfvcpklpdsiekalvlvlgkkeqigvtrfhmvhvddvarahiyllensvpggryncspf
ivpieemsqllsakypeyqiltvdelkeikgarlpdlntkklvdagfdfkytiedmfdda
iqcckekgyl

SCOPe Domain Coordinates for d2p4hx_:

Click to download the PDB-style file with coordinates for d2p4hx_.
(The format of our PDB-style files is described here.)

Timeline for d2p4hx_: