Lineage for d2p0ka1 (2p0k A:27-133)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311123Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1311281Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1311282Protein automated matches [191144] (2 species)
    not a true protein
  7. 1311290Species Human (Homo sapiens) [TaxId:9606] [189286] (4 PDB entries)
  8. 1311293Domain d2p0ka1: 2p0k A:27-133 [231111]
    automated match to d1oz3a1
    complexed with cl, po4

Details for d2p0ka1

PDB Entry: 2p0k (more details), 1.75 Å

PDB Description: Crystal structure of SCMH1
PDB Compounds: (A:) Polycomb protein SCMH1

SCOPe Domain Sequences for d2p0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0ka1 b.34.9.0 (A:27-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hftwdkylketcsvpapvhcfkqsytppsnefkismkleaqdprnttstciatvvgltga
rlrlrldgsdnkndfwrlvdsaeiqpignceknggmlqpplgfrlna

SCOPe Domain Coordinates for d2p0ka1:

Click to download the PDB-style file with coordinates for d2p0ka1.
(The format of our PDB-style files is described here.)

Timeline for d2p0ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0ka2